PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g14600.1.p
Common NameBRADI_5g14600, LOC100821263
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 342aa    MW: 35910.9 Da    PI: 5.9001
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g14600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.26.9e-082153437
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkgH 37
                      r C+ +  + ++lfC+ +  +lC  C    H gH
  Bradi5g14600.1.p 21 RACDACAGEAARLFCRADAAFLCTGCDARAH-GH 53
                      67****************************9.76 PP

2zf-B_box24.65.1e-0860105342
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                        + C+ +e+ ++   C+ +   lC+ C   +H        H++vp+
  Bradi5g14600.1.p  60 VWLCEVCEHAPAAVTCKADAAALCAACDADIHAAnplarrHERVPV 105
                       679*****************************66888889999986 PP

3CCT706.2e-24243285143
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                       Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k+
  Bradi5g14600.1.p 243 REARLMRYREKRKSRRFEKTIRYASRKAYAETRPRVKGRFAKR 285
                       9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.3381862IPR000315B-box-type zinc finger
SMARTSM003361.1E-61862IPR000315B-box-type zinc finger
CDDcd000219.75E-82162No hitNo description
PfamPF006436.6E-62153IPR000315B-box-type zinc finger
PROSITE profilePS5011910.46658105IPR000315B-box-type zinc finger
PfamPF006437.1E-660105IPR000315B-box-type zinc finger
SMARTSM003369.1E-963105IPR000315B-box-type zinc finger
PfamPF062036.4E-18243285IPR010402CCT domain
PROSITE profilePS5101716.936243285IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEGEEKSVAA GAGAYWGVGA RACDACAGEA ARLFCRADAA FLCTGCDARA HGHGSRHARV  60
WLCEVCEHAP AAVTCKADAA ALCAACDADI HAANPLARRH ERVPVAPFFG ALDVDAPNKH  120
FVGGAGAHAP AAAGINNEED EDDRSNDAEA ASWLLPEPDQ KVGGAFFADS DPYNLDLDFA  180
RSMDDIKAIS VQLNGAQAEL GLTGGNNKLF YSDHSMNHSV TSSEAAVVPE SAPVAVVSRG  240
REREARLMRY REKRKSRRFE KTIRYASRKA YAETRPRVKG RFAKRTGNGG AAALGEEEDE  300
HEGLYSSAAA AVAALLQAPG AGHGHGPELD YGVDGVVPTL V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6066271e-115AL606627.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0067K08, complete sequence.
GenBankAP0149601e-115AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126121e-115CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552091e-115CR855209.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0092E01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580070.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3-like
SwissprotQ9SK535e-71COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLI1IZ980.0I1IZ98_BRADI; Uncharacterized protein
STRINGBRADI5G14600.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-19CONSTANS-like 4